Product Description
Size: 20ul / 100ul
The EGLN3 (83321-1-RR) by Proteintech is a Recombinant antibody targeting EGLN3 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples
83321-1-RR targets EGLN3 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IF/ICC detected in: HepG2 cells
Positive FC (Intra) detected in: A549 cells, MCF-7 cells
Recommended dilution
Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
EGLN3, also named as HPH-1, HIF-PH3, HPH-3 and PHD3, is a cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. It is a regulator of cardiomyocyte and neuronal apoptosis. EGLN3 can be a prognostic marker for gastric cancer.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag27464 Product name: Recombinant human EGLN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC010992 Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK Predict reactive species
Full Name: egl nine homolog 3 (C. elegans)
Calculated Molecular Weight: 27 kDa
Observed Molecular Weight: 27 kDa
GenBank Accession Number: BC010992
Gene Symbol: EGLN3
Gene ID (NCBI): 112399
RRID: AB_3670987
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q9H6Z9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924