{"product_id":"proteintech-83324-1-rr","title":"Proteintech, 83324-1-RR, GANAB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GANAB (83324-1-RR) by Proteintech is a Recombinant antibody targeting GANAB in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83324-1-RR targets GANAB in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells,  HepG2 cells,  mouse kidney tissue,  mouse liver tissue,  rat liver tissue,  human placenta tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30417 Product name: Recombinant human GANAB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-488 aa of BC017435 Sequence: GGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR Predict reactive species\nFull Name: glucosidase, alpha; neutral AB\nCalculated Molecular Weight: 944aa,107 kDa; 488aa,55 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC017435\nGene Symbol: GANAB\nGene ID (NCBI): 23193\nRRID: AB_3670990\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14697\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888344912041,"sku":"83324-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83324-1-rr","provider":"Iright","version":"1.0","type":"link"}