{"product_id":"proteintech-83346-6-rr","title":"Proteintech, 83346-6-RR, SLC38A7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC38A7 (83346-6-RR) by Proteintech is a Recombinant antibody targeting SLC38A7 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83346-6-RR targets SLC38A7 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, human liver tissue\nPositive FC (Intra) detected in: Caco-2 cells, U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC38A7 also known as SNAT7, is a member of the SLC38 family that encodes sodium-coupled neutral amino acid transporters. SLC38A7 is a system N transporter that has a substrate preference for L-glutamine. It also transports other amino acids with polar side chains, as well as L-histidine and L-alanine (PMID: 21511949).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35081 Product name: Recombinant human SLC38A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC001961 Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST Predict reactive species\nFull Name: solute carrier family 38, member 7\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC001961\nGene Symbol: SLC38A7\nGene ID (NCBI): 55238\nRRID: AB_3671005\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9NVC3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888517206185,"sku":"83346-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83346-6-rr","provider":"Iright","version":"1.0","type":"link"}