{"product_id":"proteintech-83362-2-rr","title":"Proteintech, 83362-2-RR, NEDD9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NEDD9 (83362-2-RR) by Proteintech is a Recombinant antibody targeting NEDD9 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83362-2-RR targets NEDD9 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  MCF-7 cells,  U-251 cells,  Raji cells,  Jurkat cells\nPositive IF\/ICC detected in: MCF-7 cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEDD9, also known as CASL, HEF1, contains an N-terminal Src homology (SH) 3 domain and an adjacent domain composed of multiple SH2-binding motifs(PMID: 8668148). Cell cycle-regulated processing produces four isoforms: p115, p105, p65, and p55. Isoform p115 arises from p105 phosphorylation and appears later in the cell cycle. Isoform p55 arises from p105 as a result of cleavage at a caspase cleavage-related site and it appears specifically at mitosis. p105 and p115 are predominantly cytoplasmic and associated with focal adhesions, whereas p55associates with the mitotic spindle(PMID: 9584194).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34170 Product name: Recombinant human NEDD9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-458 aa of BC040207 Sequence: PSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELF Predict reactive species\nFull Name: neural precursor cell expressed, developmentally down-regulated 9\nCalculated Molecular Weight: 834 aa, 93 kDa\nObserved Molecular Weight: 105 kDa, 115 kDa\nGenBank Accession Number: BC040207\nGene Symbol: NEDD9\nGene ID (NCBI): 4739\nRRID: AB_3671016\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14511\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888436924585,"sku":"83362-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83362-2-rr","provider":"Iright","version":"1.0","type":"link"}