{"product_id":"proteintech-83377-1-rr","title":"Proteintech, 83377-1-RR, RPL29 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RPL29 (83377-1-RR) by Proteintech is a Recombinant antibody targeting RPL29 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83377-1-RR targets RPL29 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  PC-3 cells,  U-87 MG cells,  C6 cells,  NIH\/3T3 cells,\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRibosomal protein L29 (Rpl29) is a component of the large (60S) ribosomal subunit which is abundantly expressed in all cell types, plays a regulatory role in translation efficiency and is essential for protein synthesis (PMID: 17195189). In contrast to adult tissues, RPL29 displays a much more widespread pattern of expression throughout embryonic development, and high levels of RPL29 are found in all developing organs. Several reports showed that RPL29 expression is up-regulated in human carcinomas and constitutes a candidate marker for abnormal growth when overexpressed(PMID: 9788632, 10383165).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34100 Product name: Recombinant human RPL29 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-97 aa of BC008926 Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLA Predict reactive species\nFull Name: ribosomal protein L29\nCalculated Molecular Weight: 159 aa, 18 kDa\nObserved Molecular Weight: 20-25 kDa\nGenBank Accession Number: BC008926\nGene Symbol: RPL29\nGene ID (NCBI): 6159\nRRID: AB_3671030\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P47914\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888442003625,"sku":"83377-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83377-1-rr","provider":"Iright","version":"1.0","type":"link"}