Proteintech, 83412-4-RR, SLC6A7 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC6A7 (83412-4-RR) by Proteintech is a Recombinant antibody targeting SLC6A7 in IHC, ELISA applications with reactivity to human, mouse, rat samples 83412-4-RR targets SLC6A7 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SLC6A7 also known as PROT, belongs to the solute Carrier 6 gene family. SLC6A7 is a high-affinity mammalian brain L-proline transporter, which is different from other sodium-dependent plasma membrane carriers, and has unique pharmacological specificity, kinetic properties, and ionic requirements. SLC6A7 is a brain specific sodium (and chloride)-dependent proline transporter, that terminates the action of proline by its high affinity sodium-dependent reuptake into presynaptic terminals(PMID: 7651355). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34413 Product name: Recombinant human SLC6A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-214 aa of BC093785 Sequence: AYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHIQGSQGIGSPGEIR Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 Calculated Molecular Weight: 636 aa, 71 kDa GenBank Accession Number: BC093785 Gene Symbol: SLC6A7 Gene ID (NCBI): 6534 RRID: AB_3671059 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q99884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.