{"product_id":"proteintech-83412-4-rr","title":"Proteintech, 83412-4-RR, SLC6A7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC6A7 (83412-4-RR) by Proteintech is a Recombinant antibody targeting SLC6A7 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n83412-4-RR targets SLC6A7 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC6A7 also known as PROT, belongs to the solute Carrier 6 gene family. SLC6A7 is a high-affinity mammalian brain L-proline transporter, which is different from other sodium-dependent plasma membrane carriers, and has unique pharmacological specificity, kinetic properties, and ionic requirements. SLC6A7 is a brain specific sodium (and chloride)-dependent proline transporter, that terminates the action of proline by its high affinity sodium-dependent reuptake into presynaptic terminals(PMID: 7651355).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34413 Product name: Recombinant human SLC6A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-214 aa of BC093785 Sequence: AYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHIQGSQGIGSPGEIR Predict reactive species\nFull Name: solute carrier family 6 (neurotransmitter transporter, L-proline), member 7\nCalculated Molecular Weight: 636 aa, 71 kDa\nGenBank Accession Number: BC093785\nGene Symbol: SLC6A7\nGene ID (NCBI): 6534\nRRID: AB_3671059\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q99884\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888823324841,"sku":"83412-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83412-4-rr","provider":"Iright","version":"1.0","type":"link"}