Proteintech, 83414-3-RR, TBX20 Recombinant monoclonal antibody

Size: 20ul / 100ul The TBX20 (83414-3-RR) by Proteintech is a Recombinant antibody targeting TBX20 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83414-3-RR targets TBX20 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: H9C2 cells Positive FC (Intra) detected in: K562 Recommended dilution Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Tbx20 is a transcription factor that is essential for proper heart development in a growing fetus. Any mutations in this gene can result in various forms of congenital heart disease. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18501 Product name: Recombinant human TBX20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC120946 Sequence: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTE Predict reactive species Full Name: T-box 20 Calculated Molecular Weight: 297 aa, 33 kDa GenBank Accession Number: BC120946 Gene Symbol: TBX20 Gene ID (NCBI): 57057 RRID: AB_3671062 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UMR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.