Proteintech, 83421-1-RR, PTDSS1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PTDSS1 (83421-1-RR) by Proteintech is a Recombinant antibody targeting PTDSS1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83421-1-RR targets PTDSS1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: Hela cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Phosphatidylserine Synthase-1 (PTDSS1 or PSS1) is one of two enzymes involved in the production of phosphatidylserine (PS), which is a quantitatively minor, but physiologically important phospholipid in mammalian cells (PMID: 24241535). Mice lacking either Ptdss1 or Ptdss2 are viable, phenotypically normal and fertile, indicating that, in mice, PSS1 and PSS2 can compensate for each other (PMID: 18343815). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14170 Product name: Recombinant human PTDSS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-473 aa of BC002376 Sequence: TTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK Predict reactive species Full Name: phosphatidylserine synthase 1 Calculated Molecular Weight: 473 aa, 56 kDa GenBank Accession Number: BC002376 Gene Symbol: PTDSS1 Gene ID (NCBI): 9791 RRID: AB_3671070 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P48651 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.