{"product_id":"proteintech-83423-1-rr","title":"Proteintech, 83423-1-RR, IFIT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IFIT1 (83423-1-RR) by Proteintech is a Recombinant antibody targeting IFIT1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n83423-1-RR targets IFIT1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IFN alpha treated HeLa cells, SGC-7901 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFIT1, also known as glucocorticoid-attenuated response gene 16 protein (GARG-16), is a 463 amino acid protein belonging to the IFIT family. IFIT genes comprise a large family with three (IFIT1, IFIT2, and IFIT3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT1 specifically bound virus PPP-RNA forms a complex with IFIT2 and IFIT3 to sequester the viral PPP-RNA and prevent virus replication.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag19691 Product name: Recombinant human IFIT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 340-460 aa of BC007091 Sequence: EVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYY Predict reactive species\nFull Name: interferon-induced protein with tetratricopeptide repeats 1\nCalculated Molecular Weight: 478 aa, 55 kDa\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC007091\nGene Symbol: IFIT1\nGene ID (NCBI): 3434\nRRID: AB_3671072\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P09914\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888431091881,"sku":"83423-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83423-1-rr","provider":"Iright","version":"1.0","type":"link"}