Proteintech, 83435-1-RR, THOC5 Recombinant monoclonal antibody

Size: 20ul / 100ul The THOC5 (83435-1-RR) by Proteintech is a Recombinant antibody targeting THOC5 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83435-1-RR targets THOC5 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6664 Product name: Recombinant human THOC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 354-683 aa of BC003615 Sequence: CKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTIAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPIFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR Predict reactive species Full Name: THO complex 5 Calculated Molecular Weight: 79 kDa GenBank Accession Number: BC003615 Gene Symbol: THOC5 Gene ID (NCBI): 8563 RRID: AB_3671077 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.