{"product_id":"proteintech-83456-6-rr","title":"Proteintech, 83456-6-RR, PMS1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PMS1 (83456-6-RR) by Proteintech is a Recombinant antibody targeting PMS1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83456-6-RR targets PMS1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HEK-293T cells,  K-562 cells,  Jurkat cells,  MOLT-4 cells,  HL-60 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, Caco-2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPMS1 Homolog 1 is a member of the DNA mismatch repair enzymes (MMREs) which is to eliminate the mismatch of insertions and deletions as a consequence of DNA polymerase errors at DNA synthesis in eukaryotes. PMS1 and MLH1 could form a heterodimer MutLβ that belongs to MMREs (PMID:25619773). In the MMR system, the MutS complex recognizes the DNA mispairs firstly, and then the Mlh1-Pms1 and other associated proteins such as PCNA, RFC, ExoI were recruited, inducing Exonuclease 1 (Exo1)-dependent and -independent MMR pathways (PMID:24981171). Mutations in this gene cause hereditary nonpolyposis colorectal cancer(HNPCC), which is also known as Lynch syndrome. It was reported that PMS1 is a widely expressed protein and located in the nucleus. Alternative splicing allows for 4 isoforms of PMS1 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28132 Product name: Recombinant human PMS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 340-616 aa of BC096331 Sequence: LPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEE Predict reactive species\nFull Name: PMS1 postmeiotic segregation increased 1 (S. cerevisiae)\nObserved Molecular Weight: 106 kDa\nGenBank Accession Number: BC096331\nGene Symbol: PMS1\nGene ID (NCBI): 5378\nRRID: AB_3671092\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P54277\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888439447721,"sku":"83456-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83456-6-rr","provider":"Iright","version":"1.0","type":"link"}