{"product_id":"proteintech-83496-1-rr","title":"Proteintech, 83496-1-RR, MDC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MDC1 (83496-1-RR) by Proteintech is a Recombinant antibody targeting MDC1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83496-1-RR targets MDC1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, HeLa cells,  HEK-293 cells,  MCF-7 cells,  K-562 cells,  PC-3 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMDC1, also named as KIAA0170 or NFBD1, is a 2089 amino acid protein, which contains two BRCT domains and one FHA domain. MDC1 localizes in the nucleus and is highly expressed in testis. MDC1 is required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2\/M phases of the cell cycle. MDC1 may serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag20135 Product name: Recombinant human MDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC152556 Sequence: MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLPFVSRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRMVKKSRTTSSSVIVPESDEEGHSPVLGGLGPPFAFNLNSDTDVEEGQQPATEEASSAARRGATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGNGVVPAGVILERSQPPGEDSDTDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKR Predict reactive species\nFull Name: mediator of DNA damage checkpoint 1\nCalculated Molecular Weight: 2089 aa, 227 kDa\nObserved Molecular Weight: 260-320 kDa\nGenBank Accession Number: BC152556\nGene Symbol: MDC1\nGene ID (NCBI): 9656\nRRID: AB_3671123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14676\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888434794665,"sku":"83496-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83496-1-rr","provider":"Iright","version":"1.0","type":"link"}