{"product_id":"proteintech-83527-3-rr","title":"Proteintech, 83527-3-RR, SLC35B4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC35B4 (83527-3-RR) by Proteintech is a Recombinant antibody targeting SLC35B4 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83527-3-RR targets SLC35B4 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC35B4 (solute carrier family 35 member B4), also known as YEA. It is expected to be located in the endoplasmic reticulum membrane, which is ubiquitinated in placenta and brain. SLC35B4 is a glycosyltransferase, which transports nucleotide sugars from the cytoplasm where they are synthesized, to the Golgi apparatus where they are utilized in the synthesis of glycoproteins, glycolipids, and proteoglycans (PMID: 15911612). Belongs to the nucleotide-sugar transporter family. SLC35B subfamily. The molecular weight of SLC35B4 is 37 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22669 Product name: Recombinant human SLC35B4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC008413 Sequence: MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMV Predict reactive species\nFull Name: solute carrier family 35, member B4\nObserved Molecular Weight: 35-37 kDa\nGenBank Accession Number: BC008413\nGene Symbol: SLC35B4\nGene ID (NCBI): 84912\nRRID: AB_3671154\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q969S0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888378597545,"sku":"83527-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83527-3-rr","provider":"Iright","version":"1.0","type":"link"}