{"product_id":"proteintech-83548-3-rr","title":"Proteintech, 83548-3-RR, GHITM Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GHITM (83548-3-RR) by Proteintech is a Recombinant antibody targeting GHITM in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83548-3-RR targets GHITM in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  SH-SY5Y cells,  mouse liver tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:600-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein that localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35170 Product name: Recombinant human GHITM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-72 aa of BC010354 Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME Predict reactive species\nFull Name: growth hormone inducible transmembrane protein\nCalculated Molecular Weight: 345 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC010354\nGene Symbol: GHITM\nGene ID (NCBI): 27069\nRRID: AB_3671167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H3K2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888427913385,"sku":"83548-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83548-3-rr","provider":"Iright","version":"1.0","type":"link"}