Proteintech, 83554-3-RR, TMEM53 Recombinant monoclonal antibody

Size: 20ul / 100ul The TMEM53 (83554-3-RR) by Proteintech is a Recombinant antibody targeting TMEM53 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83554-3-RR targets TMEM53 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TMEM53 was initially described as a nuclear envelope transmembrane (NET) protein because of its nuclear envelope localization. Research has found that TMEM53 functionality does not rely on viral RNA binding or canonical IFN responses, and TMEM53 exerts an antiviral effect on other bat HKU2-related CoVs in a species-specific manner. Therefore, TMEM53 may be a potential therapeutic target for HKU2-related CoV infections and useful for preparing for future outbreaks of this viral species. (PMID: 37584551) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21321 Product name: Recombinant human TMEM53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-277 aa of BC064520 Sequence: HFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC Predict reactive species Full Name: transmembrane protein 53 Calculated Molecular Weight: 277 aa, 32 kDa GenBank Accession Number: BC064520 Gene Symbol: TMEM53 Gene ID (NCBI): 79639 RRID: AB_3671171 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q6P2H8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.