{"product_id":"proteintech-83555-5-rr","title":"Proteintech, 83555-5-RR, NLRP6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NLRP6 (83555-5-RR) by Proteintech is a Recombinant antibody targeting NLRP6 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n83555-5-RR targets NLRP6 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOD-like receptor family pyrin domain containing 6 (NLRP6) is also named as NACHT, LRR and PYD domains-containing protein 6 and ZFML, Angiotensin II\/vasopressin receptor, NALP6 and PYPAF5. NLRP6 forms a complex with ASC and caspase-1 or caspase-11 to form an inflammasome complex cleaving pro-interleukin-1β (IL-1β) and IL-18 into their biologically active forms. The function of NLRP6 has been attributed to the maintenance of epithelial integrity and host defense against microbial infections (PMID: 33910012). NLRP6 is reported to involved in inflammasome activation, regulation of nuclear factor-κB (NF-κB) and mitogen-activated protein kinase (MAPK) signaling, antiviral interferon (IFN) signaling, mucus secretion, and antimicrobial peptide (AMP) production. NLRP6 is a novel NLR family member, that shows high expression in the intestine and liver (in contrast to NLRP3 in myeloid cells), to regulate inflammation and host defense against microbes (PMID: 32386845).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34516 Product name: Recombinant human NLRP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_138329.2 Sequence: MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSGTLLSVSEYKKKYREHVLQLHARVKERNARSVKITKRFTKLLIAPESAAPEEAMGPAEEPEPGRARRSDTHTFNRLFRRDEEGRRPLTVVL Predict reactive species\nFull Name: NLR family, pyrin domain containing 6\nCalculated Molecular Weight: 99 kDa\nObserved Molecular Weight: 98 kDa\nGenBank Accession Number: NM_138329.2\nGene Symbol: NLRP6\nGene ID (NCBI): 171389\nRRID: AB_3671172\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P59044\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888653062313,"sku":"83555-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83555-5-rr","provider":"Iright","version":"1.0","type":"link"}