{"product_id":"proteintech-83556-5-rr","title":"Proteintech, 83556-5-RR, MYO1G Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MYO1G (83556-5-RR) by Proteintech is a Recombinant antibody targeting MYO1G in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83556-5-RR targets MYO1G in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Ramos cells\nPositive IF\/ICC detected in: Jurkat cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYO1G is a plasma membrane-associated class I myosin that is abundant in T and B lymphocytes and mast cells and expressed specifically in the haematopoietic system. Class I myosins have been implicated in various cellular processes relying on actin-dependent membrane dynamics such as endocytosis, secretion, adhesion, motility and regulation of mechanosensitive channels (PMID: 19968988). MYO1G localizes to the plasma membrane linked to PIP2 and PIP3, is particularly enriched at cell-surface microvilli, and associates in an ATP-releasable manner to the actin cytoskeleton (PMID: 24310084). MYO1G can be detected as about 110-120 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22698 Product name: Recombinant human MYO1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-391 aa of BC113544 Sequence: RVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVYQRLFEWVVNRINSVMEPRGRDPRRDGKDTVI Predict reactive species\nFull Name: myosin IG\nCalculated Molecular Weight: 1018 aa, 116 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC113544\nGene Symbol: MYO1G\nGene ID (NCBI): 64005\nRRID: AB_3671173\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: B0I1T2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888436367529,"sku":"83556-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83556-5-rr","provider":"Iright","version":"1.0","type":"link"}