{"product_id":"proteintech-83562-3-rr","title":"Proteintech, 83562-3-RR, GSDMD Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GSDMD (83562-3-RR) by Proteintech is a Recombinant antibody targeting GSDMD in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to mouse samples\n83562-3-RR targets GSDMD in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, EL-4 cells,  RAW 264.7 cells,  J774A.1 cells\nPositive IF\/ICC detected in: NIH\/3T3 cells\nPositive FC (Intra) detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSDMD is a 53 kDa cytosolic protein and a member of the gasdermin protein family, which features 6 members in humans (GSDMA, -B, -C, -D, -E and -F. GSDMD was identified as the executioner of inflammasome-associated pyroptosis. Caspase-1, -11, or -4 cleave GSDMD after an aspartate residue within a central linker domain (D275 in humans and D276 in mice) to generate a 31-kDa N-terminal GSDMD fragment (GSDMD-NT) and a 22-kDa C-terminal fragment (GSDMD-CT). In addition to the canonical 31\/22 kDa cleavage products, a 43 kDa fragment has been observed under specific experimental or pathological conditions. The generation of the 43 kDa fragment was observed upon caspase-3 and -7 activation during apoptosis. This antibody can only detect full-length GSDMD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34905 Product name: Recombinant mouse Gsdmd protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 199-487 aa of BC029813 Sequence: GHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC* Predict reactive species\nFull Name: gasdermin D\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC029813\nGene Symbol: Gsdmd\nGene ID (NCBI): 69146\nRRID: AB_3671177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9D8T2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888428634281,"sku":"83562-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83562-3-rr","provider":"Iright","version":"1.0","type":"link"}