{"product_id":"proteintech-83570-4-rr","title":"Proteintech, 83570-4-RR, ANAPC10 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ANAPC10 (83570-4-RR) by Proteintech is a Recombinant antibody targeting ANAPC10 in IF\/ICC, ELISA applications with reactivity to human samples\n83570-4-RR targets ANAPC10 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe anaphase promoting complex\/cyclosome (APC\/C) is a cell cycle-regulated multimeric E3 ubiquitin ligase assembled from 13 individual subunits. The anaphase promoting complex subunit 10 (APC10) is a core subunit of APC\/C that is highly conserved in humans. APC10 genetically and physically interacts with a series of subunits of the APC\/C and is necessary for the ubiquitination activity of APC\/C by enhancing the affinity of the APC\/C for its substrate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag8487 Product name: Recombinant human ANAPC10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC005217 Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR Predict reactive species\nFull Name: anaphase promoting complex subunit 10\nCalculated Molecular Weight: 185 aa, 21 kDa\nGenBank Accession Number: BC005217\nGene Symbol: ANAPC10\nGene ID (NCBI): 10393\nRRID: AB_3671183\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UM13\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888851046569,"sku":"83570-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83570-4-rr","provider":"Iright","version":"1.0","type":"link"}