{"product_id":"proteintech-83576-4-rr","title":"Proteintech, 83576-4-RR, HBQ1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HBQ1 (83576-4-RR) by Proteintech is a Recombinant antibody targeting HBQ1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83576-4-RR targets HBQ1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHBQ1 (Hemoglobin subunit theta-1) is a member of the human alpha-globin gene cluster. HBQ1 mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue (PMID: 3657976). HBQ1 gene was transcribed in an erythroleukemia cell line. HBQ1 has transcriptionally active and may be expressed in early erythroid tissue (PMID: 3422341).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10105 Product name: Recombinant human HBQ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC056686 Sequence: MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR Predict reactive species\nFull Name: hemoglobin, theta 1\nCalculated Molecular Weight: 142 aa, 16 kDa\nObserved Molecular Weight: 10~16 kDa\nGenBank Accession Number: BC056686\nGene Symbol: HBQ1\nGene ID (NCBI): 3049\nRRID: AB_3671187\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P09105\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888641331369,"sku":"83576-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83576-4-rr","provider":"Iright","version":"1.0","type":"link"}