Proteintech, 83582-5-RR, TRIM15 Recombinant monoclonal antibody

Size: 20ul / 100ul The TRIM15 (83582-5-RR) by Proteintech is a Recombinant antibody targeting TRIM15 in IF/ICC, ELISA applications with reactivity to human samples 83582-5-RR targets TRIM15 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information TRIM15 (Tripartite motif-containing protein 15) is also named as RNF93, ZNF178, ZNFB7 and belongs to the TRIM/RBCC family. It acts as an ubiquitin-protein ligase and contributes to the endogenous restriction of retroviruses in cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4533 Product name: Recombinant human TRIM15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-270 aa of BC038585 Sequence: MPATPSLKVVHELPACTLCAGPLEDAVTIPCGHTFCRLCLPALSQMGAQSSGKILLCPLCQEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDRLRSRLEALSTERDEIEDVKCQEDQKLQVLLTQIESKKHQVETAFERLQQELEQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRVNQSRCEMKTFVSPEAISPDLVKKIRDFHRK Predict reactive species Full Name: tripartite motif-containing 15 Calculated Molecular Weight: 465 aa, 52 kDa GenBank Accession Number: BC038585 Gene Symbol: TRIM15 Gene ID (NCBI): 89870 RRID: AB_3671196 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9C019 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.