Proteintech, 83589-5-RR, PEBP4 Recombinant monoclonal antibody

Size: 20ul / 100ul The PEBP4 (83589-5-RR) by Proteintech is a Recombinant antibody targeting PEBP4 in IF/ICC, ELISA applications with reactivity to human samples 83589-5-RR targets PEBP4 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: A549 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information PEBP4 (Phosphatidylethanolamine binding protein 4) is a multifunctional protein that belongs to a small family (PEBP1-4) in mammalian cells. PEBP4 is evolutionally divergent from the other three forms that share almost 80% identity and more than 90% similarity, suggesting that PEBP4 is functionally different from other forms. At cellular levels, it has been shown that the knockdown of PEBP4 in cancer cells suppresses cell proliferation, migration, and invasion, leading to their apoptosis. In contrast, overexpression of PEBP4 induces opposite changes and confers resistance to chemotherapy and radiotherapy (PMID: 35955931). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9710 Product name: Recombinant human PEBP4 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 22-223 aa of BC020779 Sequence: GDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKEGKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRGRASEPKHKTRRR Predict reactive species Full Name: phosphatidylethanolamine-binding protein 4 Calculated Molecular Weight: 223 aa, 25 kDa GenBank Accession Number: BC020779 Gene Symbol: PEBP4 Gene ID (NCBI): 157310 RRID: AB_3671203 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96S96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.