{"product_id":"proteintech-83589-5-rr","title":"Proteintech, 83589-5-RR, PEBP4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PEBP4 (83589-5-RR) by Proteintech is a Recombinant antibody targeting PEBP4 in IF\/ICC, ELISA applications with reactivity to human samples\n83589-5-RR targets PEBP4 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPEBP4 (Phosphatidylethanolamine binding protein 4) is a multifunctional protein that belongs to a small family (PEBP1-4) in mammalian cells. PEBP4 is evolutionally divergent from the other three forms that share almost 80% identity and more than 90% similarity, suggesting that PEBP4 is functionally different from other forms. At cellular levels, it has been shown that the knockdown of PEBP4 in cancer cells suppresses cell proliferation, migration, and invasion, leading to their apoptosis. In contrast, overexpression of PEBP4 induces opposite changes and confers resistance to chemotherapy and radiotherapy (PMID: 35955931).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9710 Product name: Recombinant human PEBP4 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 22-223 aa of BC020779 Sequence: GDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKEGKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRGRASEPKHKTRRR Predict reactive species\nFull Name: phosphatidylethanolamine-binding protein 4\nCalculated Molecular Weight: 223 aa, 25 kDa\nGenBank Accession Number: BC020779\nGene Symbol: PEBP4\nGene ID (NCBI): 157310\nRRID: AB_3671203\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q96S96\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888863989929,"sku":"83589-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83589-5-rr","provider":"Iright","version":"1.0","type":"link"}