{"product_id":"proteintech-83593-5-rr","title":"Proteintech, 83593-5-RR, Neurogranin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Neurogranin (83593-5-RR) by Proteintech is a Recombinant antibody targeting Neurogranin in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83593-5-RR targets Neurogranin in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeurogranin (formerly designated p17, also known as Ng, RC3 and BICKS) belongs to the neurogranin family. It is a neuron-specific substrate for protein kinase C (PKC). It is a postsynaptic protein that is highly enriched in brain, with restricted expression in the cortex, striatum, hippocampus, thalamus, hypothalamus and olfactory bulb nuclei. Neurogranin binds calmodulin at low levels of calcium, thereby regulating calmodulin-dependent nitric oxide synthase. Neurogranin acts as a \"third messenger\" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. It binds to calmodulin in the absence of calcium.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0676 Product name: Recombinant human NRGN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC002835 Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Predict reactive species\nFull Name: neurogranin (protein kinase C substrate, RC3)\nCalculated Molecular Weight: 7.6 kDa\nObserved Molecular Weight: 15-17 kDa\nGenBank Accession Number: BC002835\nGene Symbol: Neurogranin\nGene ID (NCBI): 4900\nRRID: AB_3671208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q92686\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888437121193,"sku":"83593-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83593-5-rr","provider":"Iright","version":"1.0","type":"link"}