Proteintech, 83595-4-RR, KMT2C Recombinant monoclonal antibody

Size: 20ul / 100ul The KMT2C (83595-4-RR) by Proteintech is a Recombinant antibody targeting KMT2C in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83595-4-RR targets KMT2C in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Lysine (K)-specific methyltransferase 2C (KMT2C, also known as MLL3) belongs to the mixed-lineage leukemia (MLL) family of histone methyltransferases which methylate the histone 3 tail at lysine 4 (H3K4) as part of the complex proteins associated with Set 1 (COMPASS) complex. Although originally identified as oncogenic fusions in leukemia, genome-wide mutation studies have revealed frequent, presumably loss-of-function, mutations in various members of the MLL family, including MLL2/KMT2B, MLL3/KMT2C, and MLL4/KMT2D in a variety of malignancies, particularly solid tumors. Mechanistic studies of KMT2C in normal cells have focused primarily on its role in enhancer regulation by deposition of H3K4me1 marks. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28875 Product name: Recombinant human KMT2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2771-3000 aa of NM_170606 Sequence: SMFNEELDLPIDDKLDNQCVSVEPKKKEQENKTLVLSDKHSPQKKSTVTNEVKTEVLSPNSKVESKCETEKNDENKDNVDTPCSQASAHSDLNDGEKTSLHPCDPDLFEKRTNRETAGPSANVIQASTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDIRPSGSPPPPTLPASPSNHVSSLPPFIAPPGRVLDNAMNSNVTVVSRVNHVFSQGVQVNPGLIPGQSTV Predict reactive species Full Name: myeloid/lymphoid or mixed-lineage leukemia 3 Calculated Molecular Weight: 541 kDa GenBank Accession Number: NM_170606 Gene Symbol: KMT2C Gene ID (NCBI): 58508 RRID: AB_3671211 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8NEZ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.