{"product_id":"proteintech-83605-6-rr","title":"Proteintech, 83605-6-RR, SFRS11 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SFRS11 (83605-6-RR) by Proteintech is a Recombinant antibody targeting SFRS11 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83605-6-RR targets SFRS11 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HepG2 cells,  THP-1 cells,  HeLa cells,  K-562 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSRS11 (Serine\/arginine-rich splicing factor 11) may function in pre-mRNA splicing. It is localized in the cell nucleus and can colocalize with spliceosome components.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24932 Product name: Recombinant human SFRS11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 398-483 aa of BC040436 Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 11\nCalculated Molecular Weight: 483 aa, 53 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC040436\nGene Symbol: SFRS11\nGene ID (NCBI): 9295\nRRID: AB_3671218\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q05519\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888443019433,"sku":"83605-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83605-6-rr","provider":"Iright","version":"1.0","type":"link"}