{"product_id":"proteintech-83619-5-rr","title":"Proteintech, 83619-5-RR, CUL3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CUL3 (83619-5-RR) by Proteintech is a Recombinant antibody targeting CUL3 in WB, IP, ELISA applications with reactivity to human samples\n83619-5-RR targets CUL3 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, SH-SY5Y cells,  PC-12 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCullin-RING-based BCR (BTB-CUL3-RBX1) E3 ligase are the largest family of ubiquitin ligases which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. One of seven cullin proteins serves as a scaffold protein for the assembly of the multisubunit ubiquitin ligase complex. CUL3 (Cullin-3) ubiquitin ligase complex targets multiple substrate for ubiquitination including cyclin E and of cyclin D1. Defects in CUL3 are the cause of Pseudohypoaldosteronism type 2E (PHA2E) characterized by severe hypertension, hyperkalemia, hyperchloremia, hyperchloremic metabolic acidosis, and correction of physiologic abnormalities by thiazide diuretics.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1555 Product name: Recombinant human CUL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 469-768 aa of BC039598 Sequence: KLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA Predict reactive species\nFull Name: cullin 3\nCalculated Molecular Weight: 89 kDa\nObserved Molecular Weight: 80-89 kDa\nGenBank Accession Number: BC039598\nGene Symbol: CUL3\nGene ID (NCBI): 8452\nRRID: AB_3671232\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q13618\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888608432297,"sku":"83619-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83619-5-rr","provider":"Iright","version":"1.0","type":"link"}