{"product_id":"proteintech-83628-1-rr","title":"Proteintech, 83628-1-RR, UBC12 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe UBC12 (83628-1-RR) by Proteintech is a Recombinant antibody targeting UBC12 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83628-1-RR targets UBC12 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, L02 cells,  SMMC-7721 cells,  A549 cells,  HT-1080 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE2M (Ubiquitin-conjugating enzyme E2 M), also called UBC12, accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction between UBE2M and the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation (PMID: 10207026; 15361859).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5984 Product name: Recombinant human UBC12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-183 aa of BC058924 Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC058924\nGene Symbol: UBC12\nGene ID (NCBI): 9040\nRRID: AB_3671241\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P61081\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888672166057,"sku":"83628-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83628-1-rr","provider":"Iright","version":"1.0","type":"link"}