{"product_id":"proteintech-83635-2-rr","title":"Proteintech, 83635-2-RR, CDK2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CDK2 (83635-2-RR) by Proteintech is a Recombinant antibody targeting CDK2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples\n83635-2-RR targets CDK2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, K-562 cells,  HEK-293 cells,  HeLa cells,  HepG2 cells,  C6 cells\nPositive IHC detected in: human ovarian  cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily,CMGC Ser\/Thr protein kinase family, CDC2\/CDKX subfamily.It is involved in the control of the cell cycle; essential for meiosis, but dispensable for mitosis.It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species\nFull Name: cyclin-dependent kinase 2\nCalculated Molecular Weight: 298 aa, 34 kDa\nObserved Molecular Weight: 30-33 kDa\nGenBank Accession Number: BC003065\nGene Symbol: CDK2\nGene ID (NCBI): 1017\nRRID: AB_3671245\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P24941\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888403697833,"sku":"83635-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83635-2-rr","provider":"Iright","version":"1.0","type":"link"}