{"product_id":"proteintech-83658-2-rr","title":"Proteintech, 83658-2-RR, RNF216 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RNF216 (83658-2-RR) by Proteintech is a Recombinant antibody targeting RNF216 in WB, FC (Intra), IP, ELISA applications with reactivity to human samples\n83658-2-RR targets RNF216 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SW480 cells, Caco-2 cells\nPositive IP detected in: SW480 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF216\/TRIAD3 is an RBR (RING-between-RING) E3 ligase that encodes for multiple isoforms that include TRIAD3A, TRIAD3B, TRIAD3C and TRIAD3D\/E. RNF216 is a broadly expressed RBR E3 ligase, and loss-of-function mutations in RNF216 are linked to the neurode-generative conditions Gordon-Holmes syndrome (GHS) and Huntington-like disorders (PMID: 34998453, 35620441). RNF216 has three different molecular weights, 99 kDa, 106 kDa and 57 kDa, respectively. Western analysis detected the ~130 kDa band as indicated in literature (PMID: 21270397).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0238 Product name: Recombinant human RNF216 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-276 aa of BC000787 Sequence: KRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTS Predict reactive species\nFull Name: ring finger protein 216\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 57 kDa, 90-99 kDa, 106~130 kDa\nGenBank Accession Number: BC000787\nGene Symbol: RNF216\nGene ID (NCBI): 54476\nRRID: AB_3671266\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NWF9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888360476841,"sku":"83658-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83658-2-rr","provider":"Iright","version":"1.0","type":"link"}