{"product_id":"proteintech-83667-2-rr","title":"Proteintech, 83667-2-RR, UQCRC2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe UQCRC2 (83667-2-RR) by Proteintech is a Recombinant antibody targeting UQCRC2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n83667-2-RR targets UQCRC2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  Jurkat cells,  HeLa cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUQCRC2(Ubiquinol-cytochrome-c reductase complex core protein 2) is also named as complex III subunit 2,core protein II and belongs to the UQCRC2\/QCR2 subfamily. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske\/UQCRFS1), 2 core proteins (UQCRC1\/QCR1 and UQCRC2\/QCR2) and 6 low-molecular weight proteins (UQCRH\/QCR6, UQCRB\/QCR7, UQCRQ\/QCR8, UQCR10\/QCR9, UQCR11\/QCR10 and a cleavage product of Rieske\/UQCRFS1) and is part of the mitochondrial respiratory chain. This protein distributes in mitochondrion inner membrane, peripheral membrane protein and matrix side.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6432 Product name: Recombinant human UQCRC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-453 aa of BC000484 Sequence: IEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL Predict reactive species\nFull Name: ubiquinol-cytochrome c reductase core protein II\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC000484\nGene Symbol: UQCRC2\nGene ID (NCBI): 7385\nRRID: AB_3671273\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P22695\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888380891305,"sku":"83667-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83667-2-rr","provider":"Iright","version":"1.0","type":"link"}