{"product_id":"proteintech-83685-4-rr","title":"Proteintech, 83685-4-RR, CHI3L1\/YKL40 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CHI3L1\/YKL40 (83685-4-RR) by Proteintech is a Recombinant antibody targeting CHI3L1\/YKL40 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83685-4-RR targets CHI3L1\/YKL40 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells\nPositive FC (Intra) detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChitinase 3-like-1 (CHI3L1\/YKL-40\/CGP-39\/GP-39\/hCGP-39) is a protein secreted from restricted cell types including colonic epithelial cells (CECs) and macrophages. CHI3L1 is an inflammation-associated molecule, and its expression is enhanced in persons with colitis and colon cancer. CHI3L1 is a 40 kDa protein and is produced by restricted cell types, including colonic epithelial cells (CECs) and macrophages. CHI3L1 can be detected in the Golgi apparatus and the endoplasmic reticulum, but its major sites of action seems to be extracellular as a secreted protein. (PMID:21763261)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33123 Product name: Recombinant human CHI3L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-383 aa of BC008568 Sequence: FRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISGPGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT Predict reactive species\nFull Name: chitinase 3-like 1 (cartilage glycoprotein-39)\nCalculated Molecular Weight: 383 aa, 43 kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: BC008568\nGene Symbol: CHI3L1\nGene ID (NCBI): 1116\nRRID: AB_3671287\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P36222\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888404320425,"sku":"83685-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83685-4-rr","provider":"Iright","version":"1.0","type":"link"}