{"product_id":"proteintech-83710-1-rr","title":"Proteintech, 83710-1-RR, FHIT Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FHIT (83710-1-RR) by Proteintech is a Recombinant antibody targeting FHIT in WB, IHC, ELISA applications with reactivity to human samples\n83710-1-RR targets FHIT in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HEK-293 cells,  HL-60 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe candidate tumor suppressor gene, FHIT(Fragile histidine triad protein), encompasses the common human chromosomal fragile site at 3p14.2, the hereditary renal cancer translocation breakpoint, and cancer cell homozygous deletions. Fhit hydrolyzes dinucleotide 5',5'''-P1,P3-triphosphate in vitro and mutation of a central histidine abolishes hydrolase activity(PMID:9391102). FHIT has a major role in regulating beta-catenin-mediated gene transcription.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4181 Product name: Recombinant human FHIT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC032336 Sequence: MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ Predict reactive species\nFull Name: fragile histidine triad gene\nCalculated Molecular Weight: 147 aa, 17 kDa\nObserved Molecular Weight: 15-17 kDa\nGenBank Accession Number: BC032336\nGene Symbol: FHIT\nGene ID (NCBI): 2272\nRRID: AB_3671313\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P49789\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888636776617,"sku":"83710-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83710-1-rr","provider":"Iright","version":"1.0","type":"link"}