Proteintech, 83732-2-RR, POT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The POT1 (83732-2-RR) by Proteintech is a Recombinant antibody targeting POT1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83732-2-RR targets POT1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: U2OS cells, SH-SY5Y cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Protection of telomeres 1(POT1) is a conserved protein that binds the G-rich stand of its own telomeric repeat sequence, with a role in protecting chromosome ends. It's housekeeping gene that is required to ensure the integrity of chromosome ends in all cells. It's a component of the telomerase ribonucleoprotein(RNP) complex that is esential for the replication of chromosome termini. It consists the TRF1 compex that is involved in the regulation of telomere length by cis-inhibition of telomerase. We have discovered that POT1 exists in at least three consistently occurring forms; 90, 70 and 45kDa. The unexpected molecular weights of POT1 seem to be associated with SUMO1 and ubiquitin conjugation; the latter occurring at a double lysine residue at 289-KK-290 (.PMID: 24054699) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0875 Product name: Recombinant human POT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-634 aa of BC002923 Sequence: ILTDHQYLERTPLCAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI Predict reactive species Full Name: POT1 protection of telomeres 1 homolog (S. pombe) Calculated Molecular Weight: 71 kDa GenBank Accession Number: BC002923 Gene Symbol: POT1 Gene ID (NCBI): 25913 RRID: AB_3671332 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NUX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.