Proteintech, 83755-2-RR, RNF139 Recombinant monoclonal antibody

Size: 20ul / 100ul The RNF139 (83755-2-RR) by Proteintech is a Recombinant antibody targeting RNF139 in WB, FC (Intra), ELISA applications with reactivity to human samples 83755-2-RR targets RNF139 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, U-87 MG cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The RNF139 gene (ring-finger protein 139), also known as TRC8 (translocation in renal carcinoma from chromosome 8), was first identified from a family with 3;8 chromosomal translocation and hereditary renal cell carcinoma and thyroid cancer (PMID:22689053). RNF139 encodes an endoplasmic reticulum (ER) protein with 10 transmembrane segments that contain a sterol-sensing domain and a RING finger motif encoding an E3 ubiquitin ligase (PMID: 19706601). Northern blot and dot blot show that RNF139 is highly expressed in the testis, placenta, and adrenal gland and is expressed at lower levels in the heart, brain, liver, skeletal muscle, and pancreas (PMID: 9689122). It is reported that TRC8 suppresses tumorigenesis by targeting heme oxygenase-1 (HO-1), an antioxidant enzyme highly expressed in various cancers, for ubiquitination and degradation (PMID:22689053). TRC8 is also involved in cholesterol and fatty acid biosynthesis that are transcriptionally regulated by the sterol response element binding proteins (SREBPs) (PMID:17016439). Acetylation, phosphorylation, and autoubiquitination are common post-translational modifications of FNF139 protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21530 Product name: Recombinant human RNF139 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 589-664 aa of BC064636 Sequence: VYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD Predict reactive species Full Name: ring finger protein 139 Calculated Molecular Weight: 664 aa, 76 kDa Observed Molecular Weight: 76 kDa GenBank Accession Number: BC064636 Gene Symbol: RNF139 Gene ID (NCBI): 11236 RRID: AB_3671352 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8WU17 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.