{"product_id":"proteintech-83798-6-rr","title":"Proteintech, 83798-6-RR, YAF2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe YAF2 (83798-6-RR) by Proteintech is a Recombinant antibody targeting YAF2 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83798-6-RR targets YAF2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, Raji cells,  HeLa cells,  SK-N-SH cells,  SH-SY5Y cells,  human heart tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYY1-associated factor 2 (YAF2)  is the binding molecule of Yin-Yang-1 (YY-1) protein and plays an important role in transcriptional regulation. YAF-2 mRNA expression was the highest in heart and skeletal muscle (PMID: 11953439).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5023 Product name: Recombinant human YAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC037777 Sequence: MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH Predict reactive species\nFull Name: YY1 associated factor 2\nCalculated Molecular Weight: 204 aa, 23 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC037777\nGene Symbol: YAF2\nGene ID (NCBI): 10138\nRRID: AB_3671387\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8IY57\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888523759785,"sku":"83798-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83798-6-rr","provider":"Iright","version":"1.0","type":"link"}