Proteintech, 83803-2-RR, MITF Recombinant monoclonal antibody

Size: 20ul / 100ul The MITF (83803-2-RR) by Proteintech is a Recombinant antibody targeting MITF in IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human samples 83803-2-RR targets MITF in IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells, HepG2 cells, A431 cells Positive FC (Intra) detected in: HeLa cells Positive ChIP-qPCR detected in: K-562 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases (PMID:22523078). Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells (PMID: 10578055). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3679 Product name: Recombinant human MITF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC012503 Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ Predict reactive species Full Name: microphthalmia-associated transcription factor Calculated Molecular Weight: 91 aa, 10 kDa, 59 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC012503 Gene Symbol: MITF Gene ID (NCBI): 4286 RRID: AB_3671391 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75030 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.