Proteintech, 83808-2-RR, GATA3 Recombinant monoclonal antibody

Size: 20ul / 100ul The GATA3 (83808-2-RR) by Proteintech is a Recombinant antibody targeting GATA3 in IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human samples 83808-2-RR targets GATA3 in IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: Jurkat cells, U-937 cells Positive ChIP-qPCR detected in: MCF-7 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information GATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression. This is a rabbit polyclonal antibody raised against part of C-terminus of human GATA3. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0174 Product name: Recombinant human GATA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-442 aa of BC003070 Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM Predict reactive species Full Name: GATA binding protein 3 Calculated Molecular Weight: 443 aa, 48 kDa GenBank Accession Number: BC003070 Gene Symbol: GATA3 Gene ID (NCBI): 2625 RRID: AB_3671396 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P23771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.