{"product_id":"proteintech-83818-1-rr","title":"Proteintech, 83818-1-RR, PSENEN Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PSENEN (83818-1-RR) by Proteintech is a Recombinant antibody targeting PSENEN in WB, ELISA applications with reactivity to human samples\n83818-1-RR targets PSENEN in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSENEN, also named PEN2, is a component of the gamma-secretase complex, which also includes presenilin (PSEN1) and nicastrin (NCSTN). The gamma-secretase complex is required for the intramembrane proteolysis of a number of membrane proteins, including the amyloid-beta precursor protein (APP) and Notch. PSENEN is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9243 Product name: Recombinant human PSENEN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC009575 Sequence: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP Predict reactive species\nFull Name: presenilin enhancer 2 homolog (C. elegans)\nCalculated Molecular Weight: 101 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC009575\nGene Symbol: PSENEN\nGene ID (NCBI): 55851\nRRID: AB_3671404\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9NZ42\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888659550377,"sku":"83818-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83818-1-rr","provider":"Iright","version":"1.0","type":"link"}