{"product_id":"proteintech-83835-1-rr","title":"Proteintech, 83835-1-RR, BCRP\/ABCG2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BCRP\/ABCG2 (83835-1-RR) by Proteintech is a Recombinant antibody targeting BCRP\/ABCG2 in WB, ELISA applications with reactivity to human, mouse samples\n83835-1-RR targets BCRP\/ABCG2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, U-251 cells,  MCF-7 cells,  SGC-7901 cells,  HepG2 cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25911 Product name: Recombinant human BCRP,ABCG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 557-630 aa of BC021281 Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH Predict reactive species\nFull Name: ATP-binding cassette, sub-family G (WHITE), member 2\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 68-72 kDa\nGenBank Accession Number: BC021281\nGene Symbol: ABCG2\nGene ID (NCBI): 9429\nRRID: AB_3671417\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UNQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888591065257,"sku":"83835-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83835-1-rr","provider":"Iright","version":"1.0","type":"link"}