{"product_id":"proteintech-83844-5-rr","title":"Proteintech, 83844-5-RR, SLC31A1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC31A1 (83844-5-RR) by Proteintech is a Recombinant antibody targeting SLC31A1 in WB, ELISA applications with reactivity to human samples\n83844-5-RR targets SLC31A1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SW480 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC31A1, also known as CTR1, COPT1 and solute carrier family 31 member 1, is a high-affinity copper transporter found in the cell membrane of human cells. It plays a crucial role in maintaining copper homeostasis within the body and functions as a homotrimer to influence dietary copper absorption in the cell membrane (PMID: 37853210; 28507097). SLC31A1 has three putative transmembrane domains, with an N-terminus located extracellularly and a C-terminus located intracellularly (PMID: 12827356). SLC31A1 can be detected a a 28 kDa band corresponding to glycosylated hCTR1 monomer, and a 24 kDa band that is unglycosylated hCTR1. In some membrane preparations a C-terminal degradation product of 17 kDa is also seen (PMID: 16135512). Additionally, SLC31A1 may also resolve as a 30 to 35 kDa and a 60 to 70 kDa protein on immunoblots, forming oligomers corresponding to the expected size of a homotrimeric complex (PMID: 12827356).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species\nFull Name: solute carrier family 31 (copper transporters), member 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21-23 kDa\nGenBank Accession Number: BC013611\nGene Symbol: SLC31A1\nGene ID (NCBI): 1317\nRRID: AB_3671429\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O15431\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888666988713,"sku":"83844-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83844-5-rr","provider":"Iright","version":"1.0","type":"link"}