Proteintech, 83845-3-RR, CYFIP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The CYFIP2 (83845-3-RR) by Proteintech is a Recombinant antibody targeting CYFIP2 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83845-3-RR targets CYFIP2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: Jurkat cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CYFIP1/2 belongs to the CYFIP family and is involved in T-cell adhesion and p53-dependent induction of apoptosis. CYFIP1 contains 1,253 amino acids and shares 88% sequence identity with CYFIP2. CYFIP1 and CYFIP2 are members of a highly conserved protein family and share approximately 99% sequence identity with their mouse orthologs. CYFIP1 has been shown to interact with the small GTPase RAC1, which is implicated in development and maintenance of neuronal structures. Consistent with FMRP and RAC1 localization in dendritic fine structures, CYFIP1/2 are present in synaptosomal extracts. This antibody can recognize both CYFIP1 and CYFIP2. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8749 Product name: Recombinant human CYFIP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 855-1253 aa of BC011762 Sequence: CYNGSTNRFVRTAIPFTQEPQRDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQSLATTC Predict reactive species Full Name: cytoplasmic FMR1 interacting protein 2 Calculated Molecular Weight: 148 kDa GenBank Accession Number: BC011762 Gene Symbol: CYFIP2 Gene ID (NCBI): 26999 RRID: AB_3671431 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96F07 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.