{"product_id":"proteintech-83847-5-rr","title":"Proteintech, 83847-5-RR, IQUB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IQUB (83847-5-RR) by Proteintech is a Recombinant antibody targeting IQUB in IHC, ELISA applications with reactivity to human, mouse samples\n83847-5-RR targets IQUB in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIQUB (IQ motif and ubiquitin domain containing) was discovered in 2002,4 which was located on chromosome 7q31.32 and its encoded protein mainly contained 2 domains, ubiquitin-like domain and IQ domain. IQUB had apparently higher expression in breast cancer than that in normal tissues, suggesting that it may act an important role in the occurrence and development of breast cancer (PMID: 29968965). IQUB is a critical RS1 adaptor in mouse sperm flagella, and is critical for sperm motility and fertilization (PMID: 36417862).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag19507 Product name: Recombinant human IQUB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC128181 Sequence: MSNQQEKYEAQNIVNSTEESDDAFDTVTIPVPSEEPQESDQTEEHESGIEQFSESHAIHVEEQSDQSFSSLEPDNEQLMEEVISPRQVSYTPQHHEKQYAMQRPNDDSLAFLDKIKSVKESLQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVTVQTGLDQYQQVPVEIVKSDFHKPFLGGFRHKVTGVEYHNAGTQTVPKRIPERLSIFCRDTQTVFQKKNLQQTTNTTSTQMTNIGVYVSNMTDKLVTPGKYFSAAEYHAQRLKAVIVIQTYYR Predict reactive species\nFull Name: IQ motif and ubiquitin domain containing\nCalculated Molecular Weight: 791 aa, 93 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC128181\nGene Symbol: IQUB\nGene ID (NCBI): 154865\nRRID: AB_3671433\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8NA54\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888432042153,"sku":"83847-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83847-5-rr","provider":"Iright","version":"1.0","type":"link"}