{"product_id":"proteintech-83884-3-rr","title":"Proteintech, 83884-3-RR, CD40L\/CD154 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD40L\/CD154 (83884-3-RR) by Proteintech is a Recombinant antibody targeting CD40L\/CD154 in WB, ELISA applications with reactivity to mouse, rat samples\n83884-3-RR targets CD40L\/CD154 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: J774A.1 cells, rat spleen tissue,  CTLL-2 cells,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:18000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe CD40 ligand (CD40L, TRAP, CD154), a member of the TNF superfamily of ligands, is expressed as either a 33 kDa transmembrane homologue or an 18 kDa soluble form (sCD154). CD40L is primarily expressed on activated CD4+ T cells and a small proportion of CD8+ T cells and platelets. It binds to CD40 on antigen-presenting cells (APC), which leads to many effects depending on the target cell type. Recent studies have suggested that CD40\/CD40L interactions regulate oxidative stress and affect various signaling pathways in both the immunological and the cardiovascular systems. The CD40\/CD40L system is also involved in tumorigenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0990 Product name: Recombinant Mouse CD40 Ligand\/TNFSF5 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-His Domain: 115-260 aa of NM_011616.2 Sequence: GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL Predict reactive species\nFull Name: CD40 ligand\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: NM_011616.2\nGene Symbol: CD154\nGene ID (NCBI): 21947\nRRID: AB_3671466\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P27548\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888402256041,"sku":"83884-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83884-3-rr","provider":"Iright","version":"1.0","type":"link"}