{"product_id":"proteintech-83902-7-rr","title":"Proteintech, 83902-7-RR, NDRG2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NDRG2 (83902-7-RR) by Proteintech is a Recombinant antibody targeting NDRG2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83902-7-RR targets NDRG2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HepG2 cells,  rat brain tissue,  mouse heart tissue,  rat heart tissue,  human heart tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nN-myc downstream-regulated gene 2 (NDRG2) is a newly identified member of the NDRG family that is highly localized and plays an important role in the regulation of astrocyte function. In astrocytes, NDRG2 affects the regulation of apoptosis, astrogliosis, blood-brain barrier integrity, and glutamate clearance. Several preclinical studies have revealed that NDRG2 is implicated in the pathogenesis of many neurological diseases, such as stroke, neurodegeneration and psychiatric disorders. Recent studies demonstrated that NDRG2 functions as a tumor suppressor and may be a prognostic predictor for many different malignant tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2629 Product name: Recombinant human NDRG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-357 aa of BC010458 Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC Predict reactive species\nFull Name: NDRG family member 2\nCalculated Molecular Weight: 371 aa, 39 kDa\nObserved Molecular Weight: 41-45 kDa\nGenBank Accession Number: BC010458\nGene Symbol: NDRG2\nGene ID (NCBI): 57447\nRRID: AB_3671484\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UN36\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888358019241,"sku":"83902-7-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83902-7-rr","provider":"Iright","version":"1.0","type":"link"}