{"product_id":"proteintech-83909-4-rr","title":"Proteintech, 83909-4-RR, ZFP161 \/ ZBTB14 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ZFP161 \/ ZBTB14 (83909-4-RR) by Proteintech is a Recombinant antibody targeting ZFP161 \/ ZBTB14 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83909-4-RR targets ZFP161 \/ ZBTB14 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, L02 cells,  Daudi cells,  Jurkat cells,  K-562 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZBTB14, also named as :ZFP161, ZNF478, is a 449 amino acid protein, which interacts with ZBTB21. ZBTB14, is a transcriptional activator of the dopamine transporter (DAT), binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. ZBTB14 Binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16125 Product name: Recombinant human ZFP161 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-449 aa of BC110519 Sequence: EDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS Predict reactive species\nFull Name: zinc finger protein 161 homolog (mouse)\nCalculated Molecular Weight: 449 aa, 51 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC110519\nGene Symbol: ZFP161\nGene ID (NCBI): 7541\nRRID: AB_3671490\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O43829\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888529592489,"sku":"83909-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83909-4-rr","provider":"Iright","version":"1.0","type":"link"}