{"product_id":"proteintech-83910-5-rr","title":"Proteintech, 83910-5-RR, FBP2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FBP2 (83910-5-RR) by Proteintech is a Recombinant antibody targeting FBP2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n83910-5-RR targets FBP2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBP2, also named muscle FBP, belongs to the FBPase class 1 family. FBP2 is a ubiquitously expressed enzyme of glycogen synthesis from non-carbohydrates, e.g., lactate (glyconeogenesis). However, it also plays a variety of non-enzymatic functions. FBP2 is involved in the regulation of hypoxia-inducible factor 1 (Hif1) stability, cell cycle-dependent events, biogenesis of mitochondria, and protection of the organelles against high reactive oxygen species (ROS)- and high Ca2+-induced stress (PMID: 32962293, PMID: 35626746). The calculated molecular weight of FBP2 is 37 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18245 Product name: Recombinant human FBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-339 aa of BC113632 Sequence: NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS Predict reactive species\nFull Name: fructose-1,6-bisphosphatase 2\nCalculated Molecular Weight: 339 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC113632\nGene Symbol: FBP2\nGene ID (NCBI): 8789\nRRID: AB_3671492\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O00757\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888426111145,"sku":"83910-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83910-5-rr","provider":"Iright","version":"1.0","type":"link"}