{"product_id":"proteintech-83945-5-rr","title":"Proteintech, 83945-5-RR, EOMES\/TBR2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EOMES\/TBR2 (83945-5-RR) by Proteintech is a Recombinant antibody targeting EOMES\/TBR2 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83945-5-RR targets EOMES\/TBR2 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NK-92 cells\nPositive IF\/ICC detected in: SH-SY5Y cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEOMES\/TRB2 (also named Eomesodermin\/Tbr2) encode T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia divide and migrate towards the surface of the cerebral cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express Pax6, while intermediate progenitor cells express Eomesodermin\/Tbr2, and postmitotic projection neurons express Tbr1 (PMID:15634788; PMID:16320258). This process also called neurogenesis, and demonstrated that Eomesodermin\/Tbr2 has been implicated in neurodevelopment. According to the mouse model, several articles showed that EOMES\/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller sub ventricular zone in the brain (PMID:18940588). What's more, Eomesodermin\/Tbr2 has also been found participating in immune response (PMID:20713880).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag27634 Product name: Recombinant human EOMES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 575-676 aa of NM_001278182 Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM Predict reactive species\nFull Name: eomesodermin homolog (Xenopus laevis)\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: NM_001278182\nGene Symbol: EOMES\nGene ID (NCBI): 8320\nRRID: AB_3671525\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O95936\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888425586857,"sku":"83945-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-83945-5-rr","provider":"Iright","version":"1.0","type":"link"}