Proteintech, 83949-4-RR, RAB5A Recombinant monoclonal antibody

Size: 20ul / 100ul The RAB5A (83949-4-RR) by Proteintech is a Recombinant antibody targeting RAB5A in WB, ELISA applications with reactivity to human, mouse, rat samples 83949-4-RR targets RAB5A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tisue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RAB5A belongs to the small GTPase superfamily and Rab family. It is required for the fusion of plasma membranes and early endosomes. The antibody is specific to RAB5A. It has no cross reaction to RAB5B or RAB5C. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2549 Product name: Recombinant human RAB5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC001267 Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Predict reactive species Full Name: RAB5A, member RAS oncogene family Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC001267 Gene Symbol: RAB5A Gene ID (NCBI): 5868 RRID: AB_3671528 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P20339 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.